KEGG   Mus musculus (house mouse): 26417
Entry
26417             CDS       T01002                                 
Symbol
Mapk3, Erk-1, Erk1, Ert2, Esrk1, Mnk1, Mtap2k, Prkm3, p44, p44erk1, p44mapk
Name
(RefSeq) mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu01522  Endocrine resistance
mmu01524  Platinum drug resistance
mmu04010  MAPK signaling pathway
mmu04012  ErbB signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04062  Chemokine signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04068  FoxO signaling pathway
mmu04071  Sphingolipid signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04114  Oocyte meiosis
mmu04140  Autophagy - animal
mmu04148  Efferocytosis
mmu04150  mTOR signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04210  Apoptosis
mmu04218  Cellular senescence
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04270  Vascular smooth muscle contraction
mmu04350  TGF-beta signaling pathway
mmu04360  Axon guidance
mmu04370  VEGF signaling pathway
mmu04371  Apelin signaling pathway
mmu04380  Osteoclast differentiation
mmu04510  Focal adhesion
mmu04520  Adherens junction
mmu04540  Gap junction
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04611  Platelet activation
mmu04613  Neutrophil extracellular trap formation
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04625  C-type lectin receptor signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu04657  IL-17 signaling pathway
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu04660  T cell receptor signaling pathway
mmu04662  B cell receptor signaling pathway
mmu04664  Fc epsilon RI signaling pathway
mmu04666  Fc gamma R-mediated phagocytosis
mmu04668  TNF signaling pathway
mmu04713  Circadian entrainment
mmu04720  Long-term potentiation
mmu04722  Neurotrophin signaling pathway
mmu04723  Retrograde endocannabinoid signaling
mmu04724  Glutamatergic synapse
mmu04725  Cholinergic synapse
mmu04726  Serotonergic synapse
mmu04730  Long-term depression
mmu04810  Regulation of actin cytoskeleton
mmu04910  Insulin signaling pathway
mmu04912  GnRH signaling pathway
mmu04914  Progesterone-mediated oocyte maturation
mmu04915  Estrogen signaling pathway
mmu04916  Melanogenesis
mmu04917  Prolactin signaling pathway
mmu04919  Thyroid hormone signaling pathway
mmu04921  Oxytocin signaling pathway
mmu04926  Relaxin signaling pathway
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu04929  GnRH secretion
mmu04930  Type II diabetes mellitus
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu04934  Cushing syndrome
mmu04935  Growth hormone synthesis, secretion and action
mmu04960  Aldosterone-regulated sodium reabsorption
mmu05010  Alzheimer disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05034  Alcoholism
mmu05132  Salmonella infection
mmu05133  Pertussis
mmu05135  Yersinia infection
mmu05140  Leishmaniasis
mmu05142  Chagas disease
mmu05145  Toxoplasmosis
mmu05152  Tuberculosis
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05163  Human cytomegalovirus infection
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05171  Coronavirus disease - COVID-19
mmu05200  Pathways in cancer
mmu05203  Viral carcinogenesis
mmu05205  Proteoglycans in cancer
mmu05206  MicroRNAs in cancer
mmu05207  Chemical carcinogenesis - receptor activation
mmu05208  Chemical carcinogenesis - reactive oxygen species
mmu05210  Colorectal cancer
mmu05211  Renal cell carcinoma
mmu05212  Pancreatic cancer
mmu05213  Endometrial cancer
mmu05214  Glioma
mmu05215  Prostate cancer
mmu05216  Thyroid cancer
mmu05218  Melanoma
mmu05219  Bladder cancer
mmu05220  Chronic myeloid leukemia
mmu05221  Acute myeloid leukemia
mmu05223  Non-small cell lung cancer
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
mmu05230  Central carbon metabolism in cancer
mmu05231  Choline metabolism in cancer
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mmu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    26417 (Mapk3)
   04012 ErbB signaling pathway
    26417 (Mapk3)
   04014 Ras signaling pathway
    26417 (Mapk3)
   04015 Rap1 signaling pathway
    26417 (Mapk3)
   04350 TGF-beta signaling pathway
    26417 (Mapk3)
   04370 VEGF signaling pathway
    26417 (Mapk3)
   04371 Apelin signaling pathway
    26417 (Mapk3)
   04668 TNF signaling pathway
    26417 (Mapk3)
   04066 HIF-1 signaling pathway
    26417 (Mapk3)
   04068 FoxO signaling pathway
    26417 (Mapk3)
   04072 Phospholipase D signaling pathway
    26417 (Mapk3)
   04071 Sphingolipid signaling pathway
    26417 (Mapk3)
   04024 cAMP signaling pathway
    26417 (Mapk3)
   04022 cGMP-PKG signaling pathway
    26417 (Mapk3)
   04151 PI3K-Akt signaling pathway
    26417 (Mapk3)
   04150 mTOR signaling pathway
    26417 (Mapk3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    26417 (Mapk3)
   04148 Efferocytosis
    26417 (Mapk3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    26417 (Mapk3)
   04210 Apoptosis
    26417 (Mapk3)
   04218 Cellular senescence
    26417 (Mapk3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    26417 (Mapk3)
   04520 Adherens junction
    26417 (Mapk3)
   04540 Gap junction
    26417 (Mapk3)
   04550 Signaling pathways regulating pluripotency of stem cells
    26417 (Mapk3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    26417 (Mapk3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    26417 (Mapk3)
   04613 Neutrophil extracellular trap formation
    26417 (Mapk3)
   04620 Toll-like receptor signaling pathway
    26417 (Mapk3)
   04621 NOD-like receptor signaling pathway
    26417 (Mapk3)
   04625 C-type lectin receptor signaling pathway
    26417 (Mapk3)
   04650 Natural killer cell mediated cytotoxicity
    26417 (Mapk3)
   04660 T cell receptor signaling pathway
    26417 (Mapk3)
   04658 Th1 and Th2 cell differentiation
    26417 (Mapk3)
   04659 Th17 cell differentiation
    26417 (Mapk3)
   04657 IL-17 signaling pathway
    26417 (Mapk3)
   04662 B cell receptor signaling pathway
    26417 (Mapk3)
   04664 Fc epsilon RI signaling pathway
    26417 (Mapk3)
   04666 Fc gamma R-mediated phagocytosis
    26417 (Mapk3)
   04062 Chemokine signaling pathway
    26417 (Mapk3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    26417 (Mapk3)
   04929 GnRH secretion
    26417 (Mapk3)
   04912 GnRH signaling pathway
    26417 (Mapk3)
   04915 Estrogen signaling pathway
    26417 (Mapk3)
   04914 Progesterone-mediated oocyte maturation
    26417 (Mapk3)
   04917 Prolactin signaling pathway
    26417 (Mapk3)
   04921 Oxytocin signaling pathway
    26417 (Mapk3)
   04926 Relaxin signaling pathway
    26417 (Mapk3)
   04935 Growth hormone synthesis, secretion and action
    26417 (Mapk3)
   04919 Thyroid hormone signaling pathway
    26417 (Mapk3)
   04928 Parathyroid hormone synthesis, secretion and action
    26417 (Mapk3)
   04916 Melanogenesis
    26417 (Mapk3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    26417 (Mapk3)
   04270 Vascular smooth muscle contraction
    26417 (Mapk3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    26417 (Mapk3)
  09156 Nervous system
   04724 Glutamatergic synapse
    26417 (Mapk3)
   04725 Cholinergic synapse
    26417 (Mapk3)
   04726 Serotonergic synapse
    26417 (Mapk3)
   04720 Long-term potentiation
    26417 (Mapk3)
   04730 Long-term depression
    26417 (Mapk3)
   04723 Retrograde endocannabinoid signaling
    26417 (Mapk3)
   04722 Neurotrophin signaling pathway
    26417 (Mapk3)
  09158 Development and regeneration
   04360 Axon guidance
    26417 (Mapk3)
   04380 Osteoclast differentiation
    26417 (Mapk3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    26417 (Mapk3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    26417 (Mapk3)
   05206 MicroRNAs in cancer
    26417 (Mapk3)
   05205 Proteoglycans in cancer
    26417 (Mapk3)
   05207 Chemical carcinogenesis - receptor activation
    26417 (Mapk3)
   05208 Chemical carcinogenesis - reactive oxygen species
    26417 (Mapk3)
   05203 Viral carcinogenesis
    26417 (Mapk3)
   05230 Central carbon metabolism in cancer
    26417 (Mapk3)
   05231 Choline metabolism in cancer
    26417 (Mapk3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    26417 (Mapk3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    26417 (Mapk3)
   05212 Pancreatic cancer
    26417 (Mapk3)
   05225 Hepatocellular carcinoma
    26417 (Mapk3)
   05226 Gastric cancer
    26417 (Mapk3)
   05214 Glioma
    26417 (Mapk3)
   05216 Thyroid cancer
    26417 (Mapk3)
   05221 Acute myeloid leukemia
    26417 (Mapk3)
   05220 Chronic myeloid leukemia
    26417 (Mapk3)
   05218 Melanoma
    26417 (Mapk3)
   05211 Renal cell carcinoma
    26417 (Mapk3)
   05219 Bladder cancer
    26417 (Mapk3)
   05215 Prostate cancer
    26417 (Mapk3)
   05213 Endometrial cancer
    26417 (Mapk3)
   05224 Breast cancer
    26417 (Mapk3)
   05223 Non-small cell lung cancer
    26417 (Mapk3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    26417 (Mapk3)
   05170 Human immunodeficiency virus 1 infection
    26417 (Mapk3)
   05161 Hepatitis B
    26417 (Mapk3)
   05160 Hepatitis C
    26417 (Mapk3)
   05171 Coronavirus disease - COVID-19
    26417 (Mapk3)
   05164 Influenza A
    26417 (Mapk3)
   05163 Human cytomegalovirus infection
    26417 (Mapk3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    26417 (Mapk3)
   05165 Human papillomavirus infection
    26417 (Mapk3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    26417 (Mapk3)
   05135 Yersinia infection
    26417 (Mapk3)
   05133 Pertussis
    26417 (Mapk3)
   05152 Tuberculosis
    26417 (Mapk3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    26417 (Mapk3)
   05140 Leishmaniasis
    26417 (Mapk3)
   05142 Chagas disease
    26417 (Mapk3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    26417 (Mapk3)
   05020 Prion disease
    26417 (Mapk3)
   05022 Pathways of neurodegeneration - multiple diseases
    26417 (Mapk3)
  09165 Substance dependence
   05034 Alcoholism
    26417 (Mapk3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    26417 (Mapk3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    26417 (Mapk3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    26417 (Mapk3)
   04934 Cushing syndrome
    26417 (Mapk3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    26417 (Mapk3)
   01524 Platinum drug resistance
    26417 (Mapk3)
   01522 Endocrine resistance
    26417 (Mapk3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    26417 (Mapk3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    26417 (Mapk3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    26417 (Mapk3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     26417 (Mapk3)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   26417 (Mapk3)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     26417 (Mapk3)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   26417 (Mapk3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase Choline_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 26417
NCBI-ProteinID: NP_036082
MGI: 1346859
Ensembl: ENSMUSG00000063065
UniProt: Q63844
Position
7:126358798..126364988
AA seq 380 aa
MAAAAAAPGGGGGEPRGTAGVVPVVPGEVEVVKGQPFDVGPRYTQLQYIGEGAYGMVSSA
YDHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRAPTLEAMRDVY
IVQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCD
LKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEML
SNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKS
DSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFDMELDDLPKER
LKELIFQETARFQPGAPEGP
NT seq 1143 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggctccggggggcgggggcggggagcccaggggaactgctggg
gtcgtcccggtggtccccggggaggtggaggtggtgaaggggcagccattcgatgtgggc
ccacgctacacgcagctgcagtacatcggcgagggcgcgtacggcatggtcagctcagct
tatgaccacgtgcgcaagaccagagtggccatcaagaagatcagcccctttgagcatcaa
acctactgtcagcgcacgctgagggagatccagatcttgctgcgattccgccatgagaat
gttataggcatccgagacatcctcagagcgcccaccctggaagccatgagagatgtttac
attgttcaggacctcatggagacagacctgtacaagctgcttaaaagccagcagctgagc
aatgaccacatctgctacttcctctaccagatcctccggggcctcaagtatatacactca
gccaatgtgctgcaccgggacctgaagccttccaatctgcttatcaacaccacctgcgac
cttaagatctgtgattttggcctggcccggattgctgaccctgagcacgaccacactggc
tttctgacggagtatgtggccacacgctggtaccgagccccagagatcatgcttaattcc
aagggctacaccaaatccatcgacatctggtctgtgggctgcattctggctgagatgctc
tccaaccggcccatcttccccggcaagcactacctggaccagctcaaccacattctaggt
atcttgggttccccatcccaggaggaccttaattgcatcattaacatgaaggcccgaaac
tacctgcagtctctgccctcgaaaaccaaggtggcttgggccaagctctttcctaaatct
gactccaaagctcttgacctgctggaccggatgttaaccttcaacccaaacaagcgcatc
acagtagaggaagcgctggctcacccttacctggaacagtactacgatccgacagatgag
ccagtggccgaggagccattcaccttcgacatggagctggatgacctccccaaggagcgg
ctgaaggagttgatcttccaggagacagcccgcttccagccaggggcgccagagggcccc
taa

DBGET integrated database retrieval system